The CobW_C domain within your query sequence starts at position 271 and ends at position 374, and its E-value is 5.34e-1.

IVTVTFEVPGSAKEECLNVFIQNLLWEKNVKNKDGHCMEVIRLKGLVSIKDKPQQMIVQGIHELYDLEESLVNWKDDAERACQLVFIGRNLDKDVLQQLFLTAV
CobW_C

CobW_C

Cobalamin synthesis protein cobW C-terminal domain
SMART ACC:SM000833
Description:CobW proteins are generally found proximal to the trimeric cobaltochelatase subunit CobN, which is essential for vitamin B12 (cobalamin) biosynthesis (PUBMED:12869542). They contain a P-loop nucleotide-binding loop in the N-terminal domain and a histidine-rich region in the C-terminal portion suggesting a role in metal binding, possibly as an intermediary between the cobalt transport and chelation systems. CobW might be involved in cobalt reduction leading to cobalt(I) corrinoids. This entry represents the C-terminal domain found in CobW, as well as in P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression (PUBMED:7765511).
InterPro ACC:IPR011629
InterPro abstract:

CobW proteins are generally found proximal to the trimeric cobaltochelatase subunit CobN, which is essential for vitamin B12 (cobalamin) biosynthesis [ PUBMED:12869542 PUBMED:24449932 ]. They contain a P-loop nucleotide-binding loop in the … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 28 563 CobW_C domains in 28 559 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CobW_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CobW_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the CobW_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CobW_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing CobW_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCobW_C
InterProIPR011629