The BID_2 domain within your query sequence starts at position 457 and ends at position 536, and its E-value is 6.9e-2.

IYFPIQLKPSFLAFPHHPLGISNRFTVQVEGGSGNFTWSSSNETVAMVTTKGVVTAGQVRGNSTILARDVQNPSRSGDIK
BID_2

BID_2

Bacterial Ig-like domain 2
SMART ACC:SM000635
Description: -
InterPro ACC:IPR003343
InterPro abstract:

The Ig-like fold is part of proteins with important roles in different physiological processes [ PUBMED:16631788 ]. This entry represents the bacterial Ig-like domain (Big2). This domain is mainly found in a variety of bacterial and phage surface proteins such as intimins, but has also been found in several eukaryote … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 37 760 BID_2 domains in 15 247 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BID_2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BID_2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BID_2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing BID_2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003343
PfamBig_2