The SPT16 domain within your query sequence starts at position 529 and ends at position 689, and its E-value is 3.38e-96.

IYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNMKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRF
SPT16

SPT16

FACT complex subunit (SPT16/CDC68)
SMART ACC:SM001286
Description:Proteins in this family are subunits the FACT complex. The FACT complex plays a role in transcription initiation and promotes binding of TATA-binding protein (TBP) to a TATA box in chromatin PMID:15987999.
InterPro ACC:IPR013953
InterPro abstract:

This entry represents a domain found in the central region of Spt16 from diverse eukaryotes [ PUBMED:21454601 PUBMED:33846633 ]. This entry covers the dimerization domain (DD), which straddles nucleosomal DNA at the H2A-H2B dyad [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 690 SPT16 domains in 1 688 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SPT16 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SPT16 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the SPT16 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SPT16 domain which could be assigned to a KEGG orthologous group, and not all proteins containing SPT16 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSPT16
InterProIPR013953