The CASc domain within your query sequence starts at position 151 and ends at position 400, and its E-value is 1.82e-136.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 94320145 ) for details.

IYPIMNTTTRTRLALIICNTEFQHLSPRVGAQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQEGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFP
CASc

CASc

Caspase, interleukin-1 beta converting enzyme (ICE) homologues
SMART ACC:SM000115
Description:Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues.
InterPro ACC:IPR015917
InterPro abstract:

This entry represents the C-terminal conserved domain found in caspases mostly from animals. This domain includes the core of p45 (45kDa) precursor of caspases, which can be processed to produce the active p20 (20kDa) and p10 (10kDa) subunits.

GO function:cysteine-type peptidase activity (GO:0008234)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 164 CASc domains in 6 090 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CASc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CASc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CASc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CASc domain which could be assigned to a KEGG orthologous group, and not all proteins containing CASc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECASc_DOMAIN
InterProIPR015917