The APCDDC domain within your query sequence starts at position 284 and ends at position 500, and its E-value is 6.26e-91.

KADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFTIYARGRYSRGVLSSKVMGGTEFVFKVNHMKVTPMDAATASLLNVFSGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDTRGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEELLEDSQGHLYGRAAGRTAGSLLLPA
APCDDC

APCDDC

Adenomatosis polyposis coli down-regulated 1
SMART ACC:SM001352
Description:The domain is duplicated in most members of this family. APCDD is directly regulated by the beta-catenin/Tcf complex, and its elevated expression promotes proliferation of colonic epithelial cells in vitro and in vivo (PMID:12384519). APCDD1 has an N-terminal signal-peptide and a C-terminal transmembrane region. The domain is rich in cysteines, there being up to 12 such residues, a structural motif important for interaction between Wnt ligands and their receptors. APCDD1 is expressed in a broad repertoire of cell types, indicating that it may regulate a diverse range of biological processes controlled by Wnt signalling (PMID:20393562).
InterPro ACC:IPR029405
InterPro abstract:

APCDD1 is directly regulated by the beta-catenin/Tcf complex, and its elevated expression promotes proliferation of colonic epithelial cells in vitro and in vivo [ PUBMED:12384519 ]. APCDD1 has an N-terminal signal-peptide and a C-terminal transmembrane region. This domain is duplicated in most members of the family. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 316 APCDDC domains in 735 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing APCDDC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing APCDDC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the APCDDC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a APCDDC domain which could be assigned to a KEGG orthologous group, and not all proteins containing APCDDC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAPCDDC
InterProIPR029405