The H2A domain within your query sequence starts at position 5 and ends at position 102, and its E-value is 3.68e-43.

KAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAELAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ
H2A

H2A

Histone 2A
SMART ACC:SM000414
Description: -
InterPro ACC:IPR002119
InterPro abstract:

Histone H2A is a small, highly conserved nuclear protein that, together with two molecules each of histones H2B, H3 and H4, forms the eukaryotic nucleosome core [ PUBMED:8121801 ]; the nucleosome octamer winds ~146 DNA base-pairs. In the mouse, histone H2A can be replaced by histone H2A-like 1 [ PUBMED:17261847 expand

GO component:nucleosome (GO:0000786)
GO function:DNA binding (GO:0003677), structural constituent of chromatin (GO:0030527)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 028 H2A domains in 7 999 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing H2A domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing H2A domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the H2A domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a H2A domain which could be assigned to a KEGG orthologous group, and not all proteins containing H2A domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEHISTONE_H2A
InterProIPR002119
Pfamhistone