The EF1G domain within your query sequence starts at position 275 and ends at position 381, and its E-value is 3.63e-78.

KAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQE
EF1G

EF1G

Elongation factor 1 gamma, conserved domain
SMART ACC:SM001183
Description: -
InterPro ACC:IPR001662
InterPro abstract:

Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [ PUBMED:12762045 PUBMED:15922593 PUBMED:12932732 ]. … expand

GO process:translational elongation (GO:0006414)
GO function:translation elongation factor activity (GO:0003746)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 200 EF1G domains in 2 196 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EF1G domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EF1G domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EF1G domain which could be assigned to a KEGG orthologous group, and not all proteins containing EF1G domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001662
PfamEF1G