The EXOIII domain within your query sequence starts at position 229 and ends at position 363, and its E-value is 1.57e-20.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 11937058 ) for details.

KALALDCEMVGVGPKGEESIAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEEFEVVKKEVAEMLKGRILVGHALHNDLKSGRPSLKRLSEKILGIRVQQAEHCSIQDAQAAMRLYVMVKREW
EXOIII

EXOIII

SMART ACC:SM000479
Description:exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases
InterPro ACC:IPR013520
InterPro abstract:

This entry includes a variety of exonuclease proteins, such as Oligoribonuclease, ribonuclease T [ PUBMED:8506149 ] and the epsilon subunit of DNA polymerase III.

Ribonuclease T ( EC:3.1.13 ) is an enzyme found so far only in gamma-subdivision … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 66 161 EXOIII domains in 66 129 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EXOIII domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EXOIII domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Replication

Relevant references for this domain

Primary literature for the EXOIII domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EXOIII domain which could be assigned to a KEGG orthologous group, and not all proteins containing EXOIII domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013520
PfamExonuclease