The Integrin_b_cyt domain within your query sequence starts at position 725 and ends at position 770, and its E-value is 1.58e-17.

KALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Integrin_b_cyt

Integrin_b_cyt

SMART ACC:SM001241
Description:Integrins are a group of transmembrane proteins which function as extracellular matrix receptors and in cell adhesion. Integrins are ubiquitously expressed and are heterodimeric, each composed of an alpha and beta subunit. Several variations of the the alpha and beta subunits exist, and association of different alpha and beta subunits can have different a different binding specificity. This domain corresponds to the cytoplasmic domain of the beta subunit.
InterPro ACC:IPR014836
InterPro abstract:

This entry represents the cytoplasmic domain of integrin beta subunits [ PUBMED:12230976 ].

Integrin beta subunits consist of an extracellular domain with a head region, a stalk/leg section, a transmembrane domain, and a cytoplasmic tail. The head region contains a β-I-like domain inserted into a hybrid domain … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 751 Integrin_b_cyt domains in 2 740 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Integrin_b_cyt domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Integrin_b_cyt domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Integrin_b_cyt domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Integrin_b_cyt domain which could be assigned to a KEGG orthologous group, and not all proteins containing Integrin_b_cyt domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014836
PfamIntegrin_b_cyt