The ALBUMIN domain within your query sequence starts at position 212 and ends at position 397, and its E-value is 3.43e-82.

KALVSSVRQRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECADDRAELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPADLPAIAADFVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCAEANPPACYGTV
ALBUMIN

ALBUMIN

serum albumin
SMART ACC:SM000103
Description: -
InterPro ACC:IPR014760
InterPro abstract:

A number of serum transport proteins are known to be evolutionarily related, including albumin, alpha-fetoprotein, vitamin D-binding protein and afamin [ PUBMED:2481749 PUBMED:2423133 PUBMED:7517938 expand

GO component:extracellular space (GO:0005615)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 862 ALBUMIN domains in 1 132 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ALBUMIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ALBUMIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ALBUMIN domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ALBUMIN domain.

ProteinDescriptionDisease / phenotype
ALBU_HUMANOMIM:103600 : Analbuminemia ; [Dysalbuminemic hyperthyroxinemia] ; [Dysalbuminemic hyperzincemia]
OMIM:194470 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ALBUMIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing ALBUMIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS00212
InterProIPR014760