The DeoC domain within your query sequence starts at position 49 and ends at position 271, and its E-value is 4.4e-50.

KAVTFIDLTTLSGDDTFSNVQRLCYKAKYPIRADLLKALNMDDKGITTAAVCVYPARVCDAVKALKAAGCSIPVASVATGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRTLVLTGQWEALYDEVTQFRKACGEAHLKTILATGELGSLTNVYKASLVAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKRSPIITIILSCEAYGKWILSN
DeoC

DeoC

DeoC/LacD family aldolase
SMART ACC:SM001133
Description:This family includes diverse aldolase enzymes. This family includes the enzyme deoxyribose-phosphate aldolase EC:4.1.2.4, which is involved in nucleotide metabolism. The family also includes a group of related bacterial proteins of unknown function, see examples Q57843 and P76143. The family also includes tagatose 1,6-diphosphate aldolase ( EC:4.1.2.40) is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation ((PUBMED:1655695)).
InterPro ACC:IPR002915
InterPro abstract:

This entry represents diverse aldolases, such as deoxyribose-phosphate aldolase, tagatose 1,6-diphosphate aldolase, fructose-bisphosphate aldolase class 1, 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase, 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase, phospho-2-dehydro-3-deoxyheptonate aldolase, and 6-deoxy-5-ketofructose 1-phosphate synthase, etc.

Aldolases play … expand

GO function:lyase activity (GO:0016829)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 24 839 DeoC domains in 24 838 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DeoC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DeoC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the DeoC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DeoC domain which could be assigned to a KEGG orthologous group, and not all proteins containing DeoC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDeoC
InterProIPR002915