The ZnF_UBP domain within your query sequence starts at position 285 and ends at position 334, and its E-value is 1.1e-27.

KCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRV
ZnF_UBP

ZnF_UBP

Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger
SMART ACC:SM000290
Description: -
InterPro ACC:IPR001607
InterPro abstract:

This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [ PUBMED:9759494 PUBMED:9409543 expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 721 ZnF_UBP domains in 5 106 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_UBP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_UBP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_UBP domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_UBP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamUCH-2
InterProIPR001607
PROSITEUCH_2_2