The LIM domain within your query sequence starts at position 475 and ends at position 526, and its E-value is 8.16e-20.

KCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVH
LIM

LIM

Zinc-binding domain present in Lin-11, Isl-1, Mec-3.
SMART ACC:SM000132
Description:Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
InterPro ACC:IPR001781
InterPro abstract:

This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 113 896 LIM domains in 51 102 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LIM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LIM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Zn2+-binding, protein-binding

Relevant references for this domain

Primary literature for the LIM domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LIM domain.

ProteinDescriptionDisease / phenotype
LMX1B_HUMANOMIM:602575 : Nail-patella syndrome
OMIM:161200 : Nail-patella syndrome with open-angle glaucoma
OMIM:137750 : no description
LHX3_HUMANOMIM:600577 : Pituitary hormone deficiency, combined, with rigid cervical spine
OMIM:262600 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LIM domain which could be assigned to a KEGG orthologous group, and not all proteins containing LIM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001781
PfamLIM