The Fib_alpha domain within your query sequence starts at position 49 and ends at position 193, and its E-value is 1.29e-69.

KDSDWPFCSDDDWNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQRNNKDSNSLTRNIMEYLRGDFANANNFDNTYGQVSEDLRRRIEILRRKVIEKAQQIQALQSNVRAQLIDMKRLEVDIDIKIRSCKGSCSRAVNREI
Fib_alpha

Fib_alpha

Fibrinogen alpha/beta chain family
SMART ACC:SM001212
Description:Fibrinogen is a protein involved in platelet aggregation and is essential for the coagulation of blood. This domain forms part of the central coiled coiled region of the protein which is formed from two sets of three non-identical chains (alpha, beta and gamma).
InterPro ACC:IPR012290
InterPro abstract:

Fibrinogen plays key roles in both blood clotting and platelet aggregation. During blood clot formation, the conversion of soluble fibrinogen to insoluble fibrin is triggered by thrombin, resulting in the polymerisation of fibrin, which forms a soft clot; this is then converted to a hard clot by factor XIIIA, which cross-links fibrin molecules. Platelet aggregation involves the binding of the … expand

GO process:platelet activation (GO:0030168), protein polymerization (GO:0051258)
GO component:fibrinogen complex (GO:0005577)
GO function:signaling receptor binding (GO:0005102)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 882 Fib_alpha domains in 870 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Fib_alpha domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Fib_alpha domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Fib_alpha domain which could be assigned to a KEGG orthologous group, and not all proteins containing Fib_alpha domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFib_alpha
InterProIPR012290