The BP28CT domain within your query sequence starts at position 1856 and ends at position 2009, and its E-value is 2.25e-77.

KEELLSHQSQLTTFFLEALDFRAQHSEDDLEEVGKTEGWIIDCLVAMVVKLSEVTFRPLFFKLFDWAKTEDAPKDRLLTFYNLADCIAEKLKGLFTLFAGHLVKPFADTLNQVNISKTDEAFFDSERDPEKCCLLLQFILNCLYKVFLFDTQNF
BP28CT

BP28CT

BP28CT (NUC211) domain
SMART ACC:SM001036
Description:This C-terminal domain is found in BAP28-like nucleolar proteins (PUBMED:15112237).
InterPro ACC:IPR012954
InterPro abstract:

This domain is found in the C-terminal of BAP28 proteins [ PUBMED:15112237 ] (which are involved in nucleolar processing of pre-18S ribosomal RNA and ribosome biosynthesis [ PUBMED:16531401 ]) and in other BAP28-like proteins.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 342 BP28CT domains in 1 339 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BP28CT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BP28CT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BP28CT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BP28CT domain which could be assigned to a KEGG orthologous group, and not all proteins containing BP28CT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012954
PfamBP28CT