The RPOL4c domain within your query sequence starts at position 24 and ends at position 141, and its E-value is 1.16e-62.

KEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQ
RPOL4c

RPOL4c

DNA-directed RNA-polymerase II subunit
SMART ACC:SM000657
Description: -
InterPro ACC:IPR006590
InterPro abstract:

DNA-directed RNA polymerases EC:2.7.7.6 (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 233 RPOL4c domains in 2 231 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RPOL4c domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RPOL4c domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the RPOL4c domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RPOL4c domain which could be assigned to a KEGG orthologous group, and not all proteins containing RPOL4c domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006590