The BTB domain within your query sequence starts at position 58 and ends at position 168, and its E-value is 7.13e-3.

KEILVNVGGQRYLLPWSTLDAFPLSRLSRLRLCRSHEEITQLCDDYDEDSQEFFFDRNPSAFGVIVSFLAAGKLVLLREMCALSFREELSYWGIEETNLERCCLRKLLKKL
BTB

BTB

Broad-Complex, Tramtrack and Bric a brac
SMART ACC:SM000225
Description:Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.
InterPro ACC:IPR000210
InterPro abstract:

The BTB domain (Broad-Complex, Tramtrack and Bric a brac) is also known as the POZ domain (POxvirus and Zinc finger). It is a homodimerisation domain occurring at the N terminus of proteins containing multiple copies of either zinc fingers of the C2H2 type or Kelch repeats [ PUBMED:7938017 PUBMED:7958847 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 113 741 BTB domains in 107 385 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BTB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BTB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BTB domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the BTB domain.

ProteinDescriptionDisease / phenotype
GAN_HUMANOMIM:256850 : Giant axonal neuropathy-1
OMIM:605379 : Giant axonal neuropathy-1
OMIM:256850 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BTB domain which could be assigned to a KEGG orthologous group, and not all proteins containing BTB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBTB
InterProIPR000210