The CULLIN domain within your query sequence starts at position 306 and ends at position 457, and its E-value is 1.12e-80.

KEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKN
CULLIN

CULLIN

Cullin
SMART ACC:SM000182
Description: -
InterPro ACC:IPR016158
InterPro abstract:

Cullins are a family of hydrophobic proteins that act as scaffolds for ubiquitin ligases (E3). Cullins are found throughout eukaryotes. Humans express several cullins (Cul1, 2, 3, 4A, 4B, 5, 7 and 9), each forming part of a multi-subunit ubiquitin complex [ PUBMED:36041947 PUBMED:24793696 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 381 CULLIN domains in 7 367 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CULLIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CULLIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CULLIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing CULLIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECULLIN_1,CULLIN_2
InterProIPR016158
PfamCullin