The DUF1856 domain within your query sequence starts at position 377 and ends at position 423, and its E-value is 2e-16.

KFAKDDSDSMSRRQTSYSNNRSPTNSTGTWKDSPKSSKSIRFIPVST
DUF1856

DUF1856

SMART ACC:SM001164
Description:This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors.
InterPro ACC:IPR015076
InterPro abstract:

This is the conserved C-terminal domain of Vasopressin V1a/b receptors (V1R), which is involved in receptor trafficking and facilitates the interaction between the intracellular loops of the receptor, the G proteins and coupling to phospholipase C [ PUBMED:16511036 PUBMED:23830982 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 366 DUF1856 domains in 365 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1856 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1856 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1856 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1856 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR015076
PfamDUF1856