The ZnF_ZZ domain within your query sequence starts at position 229 and ends at position 273, and its E-value is 3.65e-3.

KHLGIPCNNCNQLPIEGRCYKCTECVEYHLCQECFDSCCHSSHAF
ZnF_ZZ

ZnF_ZZ

Zinc-binding domain, present in Dystrophin, CREB-binding protein.
SMART ACC:SM000291
Description:Putative zinc-binding domain present in dystrophin-like proteins, and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
InterPro ACC:IPR000433
InterPro abstract:

This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions [ PUBMED:8848831 ]. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are … expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 616 ZnF_ZZ domains in 18 218 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_ZZ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_ZZ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_ZZ domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_ZZ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000433
PfamZZ