The DWB domain within your query sequence starts at position 269 and ends at position 425, and its E-value is 3.92e-76.

KHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKVSSAHPS
DWB

DWB

Domain B in dwarfin family proteins
SMART ACC:SM000524
Description: -
InterPro ACC:IPR001132
InterPro abstract:

Mammalian dwarfins are phosphorylated in response to transforming growth factor beta and are implicated in control of cell growth [ PUBMED:8799132 PUBMED:19218245 ]. The dwarfin family also includes the Drosophila protein MAD that is required … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 017 DWB domains in 5 011 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DWB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DWB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein interaction

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DWB domain which could be assigned to a KEGG orthologous group, and not all proteins containing DWB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001132
PfamDwarfin