The IPPc domain within your query sequence starts at position 526 and ends at position 693, and its E-value is 1.8e-9.

KKIRVCVGTWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKRSKPTDIFAIGFEEMVELNAGNIVNASTTNQKLWAVELQKTISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVK
IPPc

IPPc

Inositol polyphosphate phosphatase, catalytic domain homologues
SMART ACC:SM000128
Description:Mg(2+)-dependent/Li(+)-sensitive enzymes.
InterPro ACC:IPR000300
InterPro abstract:

This domain is found in diverse proteins homologous to inositol monophosphatase [ PUBMED:1660408 ]. These proteins are Mg 2+ -dependent/Li + -sensitive phosphatases that catalyse a variety of reactions.

GO process:phosphatidylinositol dephosphorylation (GO:0046856)
GO function:phosphatase activity (GO:0016791)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 295 IPPc domains in 12 285 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IPPc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IPPc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:D-myo-inositol 1, 4, 5-trisphosphate-hydrolysis

Relevant references for this domain

Primary literature for the IPPc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IPPc domain.

ProteinDescriptionDisease / phenotype
OCRL_HUMANOMIM:309000 : Lowe syndrome

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IPPc domain which could be assigned to a KEGG orthologous group, and not all proteins containing IPPc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000300