The ZnF_BED domain within your query sequence starts at position 557 and ends at position 610, and its E-value is 5.49e-15.

KKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHGHV
ZnF_BED

ZnF_BED

BED zinc finger
SMART ACC:SM000614
Description:DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 169 ZnF_BED domains in 4 785 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_BED domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_BED domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_BED domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_BED domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_BED domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain