The YL1_C domain within your query sequence starts at position 43 and ends at position 72, and its E-value is 1.73e0.

KLSASGFAQANYTDPQSKLRFSTVEEFSYI
YL1_C

YL1_C

YL1 nuclear protein C-terminal domain
SMART ACC:SM000993
Description:This domain is found in proteins of the YL1 family. These proteins have been shown to be DNA-binding and may be a transcription factor. This domain is found in proteins that are not YL1 proteins.
InterPro ACC:IPR013272
InterPro abstract:

This domain is found at the C terminus in proteins of the Vps72/YL1 family [ PUBMED:7702631 PUBMED:26974126 ], in which it represents a proline-rich domain [ PUBMED:26974126 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 828 YL1_C domains in 2 824 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing YL1_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing YL1_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the YL1_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a YL1_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing YL1_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamYL1_C
InterProIPR013272