The CAD domain within your query sequence starts at position 19 and ends at position 94, and its E-value is 1.79e-47.

KPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKW
CAD

CAD

Domains present in proteins implicated in post-mortem DNA fragmentation
SMART ACC:SM000266
Description: -
InterPro ACC:IPR003508
InterPro abstract:

The CIDE-N or CAD domain is a ~78 amino acid protein-protein interaction domain in the N-terminal part of Cell death-Inducing DFF45-like Effector (CIDE) proteins, involved in apoptosis. At the final stage of programmed cell death, chromosomal DNA is degraded into fragments by Caspase-activated DNase (CAD), also named DNA fragmentation factor 40kDa (DFF40). In normal cells CAD/DFF40 is completely … expand

GO process:apoptotic process (GO:0006915)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 356 CAD domains in 1 355 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CAD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CAD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CAD domain which could be assigned to a KEGG orthologous group, and not all proteins containing CAD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003508