The Josephin domain within your query sequence starts at position 5 and ends at position 164, and its E-value is 1.1e-89.

KQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGD
Josephin

Josephin

SMART ACC:SM001246
Description: -
InterPro ACC:IPR006155
InterPro abstract:

The Josephin domain is an eukaryotic protein module of about 180 residues, which occurs in stand-alone form in Josephin-like proteins, and as an amino- terminal domain associated with two or three copies of the ubiquitin- interacting motif (UIM) in ataxin 3-like proteins. Josephin domain-containing proteins function as de-ubiquitination enzymes [ PUBMED:17696782 expand

GO process:protein deubiquitination (GO:0016579)
GO function:cysteine-type deubiquitinase activity (GO:0004843)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 629 Josephin domains in 2 628 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Josephin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Josephin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Josephin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Josephin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamJosephin
InterProIPR006155