The Ribosomal_S15 domain within your query sequence starts at position 108 and ends at position 189, and its E-value is 4.27e-16.

KQEQLMNKIVENPEDSRTLEAQIIALTVRIRNYEEHMQKHRKDKAHKRHLLMSIDRRKKLLKILRQTNYDVFEKTCKELGVE
Ribosomal_S15

Ribosomal_S15

SMART ACC:SM001387
Description: -
InterPro ACC:IPR000589
InterPro abstract:

Small ribosomal subunit protein uS15 is one of the proteins from the small ribosomal subunit. In Escherichia coli, this protein binds to 16S ribosomal RNA and functions at early steps in ribosome assembly. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities [ PUBMED:2263452 ], groups … expand

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 547 Ribosomal_S15 domains in 19 538 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ribosomal_S15 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ribosomal_S15 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the Ribosomal_S15 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ribosomal_S15 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ribosomal_S15 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000589
PfamRibosomal_S15