The CALCITONIN domain within your query sequence starts at position 83 and ends at position 120, and its E-value is 4.54e-23.

KRCGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAPGKKR
CALCITONIN

CALCITONIN

calcitonin
SMART ACC:SM000113
Description:This family is formed by calcitonin, the calcitonin gene-related peptide, and amylin. They are short polypeptide hormones.
InterPro ACC:IPR001693
InterPro abstract:

Calcitonin [ PUBMED:3060108 ] is a 32 amino acid polypeptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in the blood, by promoting the incorporation of these ions in the bones. This is the alpha type. Alternative splicing of the gene coding for calcitonin produces a distantly … expand

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 064 CALCITONIN domains in 1 059 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CALCITONIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CALCITONIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CALCITONIN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CALCITONIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing CALCITONIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECALCITONIN
InterProIPR001693