The PYRIN domain within your query sequence starts at position 6 and ends at position 84, and its E-value is 8.33e-14.

KRIVLLRGLECINKHYFSLFKSLLARDLNLERDNQEQYTTIQIANMMEEKFPADSGLGKLIAFCEEVPALRKRAEILKK
PYRIN

PYRIN

PAAD/DAPIN/Pyrin domain
SMART ACC:SM001289
Description:This domain is predicted to contain 6 alpha helices and to have the same fold as the Death domain SM00005. This similarity may mean that this is a protein-protein interaction domain.
InterPro ACC:IPR004020
InterPro abstract:

The DAPIN (Domain in Apoptosis and INterferon response) domain is an 80-100- residue domain which is found in the N terminus of diverse vertebrate and vertebrate-specific viral proteins involved in apoptosis, cancer, inflammation, and immune response. The DAPIN domain can be found alone or in association with other domains [ PUBMED:1166557 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 728 PYRIN domains in 4 335 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PYRIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PYRIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the PYRIN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PYRIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing PYRIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPYRIN
InterProIPR004020