The PKS_KR domain within your query sequence starts at position 1878 and ends at position 2059, and its E-value is 2.33e-42.

KSYIITGGLGGFGLELARWLVLRGAQRLVLTSRSGIRTGYQAKHIREWRRQGIQVLVSTSNVSSLEGARALIAEATKLGPVGGVFNLAMVLRDAMLENQTPELFQDVNKPKYNGTLNLDRATREACPELDYFVAFSSVSCGRGNAGQTNYGFANSTMERICEQRRHDGLPGLAVQWGAIGDV
PKS_KR

PKS_KR

SMART ACC:SM000822
Description:This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
InterPro ACC:IPR057326
InterPro abstract:

The ketoreductase (KR) domain is a conserved catalytic domain that belongs to the short-chain dehydrogenase/reductase (SDR) superfamily and contains a Rossmann fold, which is crucial for binding the NADPH cofactor [ PUBMED:26863427 ]. Its primary function is to catalyse the NADPH-dependent reduction of beta-keto groups … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 38 684 PKS_KR domains in 29 018 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PKS_KR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PKS_KR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PKS_KR domain which could be assigned to a KEGG orthologous group, and not all proteins containing PKS_KR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR057326
PfamKR domain