The WAP domain within your query sequence starts at position 229 and ends at position 272, and its E-value is 1.84e-2.

KTGFCPRKPIVCSKIDKPKCLQDIDCPLDEKCCTRCGLKCLKPR
WAP

WAP

Four-disulfide core domains
SMART ACC:SM000217
Description: -
InterPro ACC:IPR008197
InterPro abstract:

The four-disulfide core (4-DSC) or WAP domain comprises eight cysteine residues involved in disulfide bonds in a conserved arrangement [ PUBMED:6896234 ]. The four disulphide core containing Whey Acidic Proteins (WAP) are the major whey proteins in the milk of many mammals and are considered to be the prototypic members … expand

GO component:extracellular region (GO:0005576)
GO function:peptidase inhibitor activity (GO:0030414)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 683 WAP domains in 7 717 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WAP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WAP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the WAP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WAP domain which could be assigned to a KEGG orthologous group, and not all proteins containing WAP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008197
PROSITEPS00317