The VWA domain within your query sequence starts at position 151 and ends at position 327, and its E-value is 2.68e-32.

KVDLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDLQR
VWA

VWA

von Willebrand factor (vWF) type A domain
SMART ACC:SM000327
Description:VWA domains in extracellular eukaryotic proteins mediate adhesion via metal ion-dependent adhesion sites (MIDAS). Intracellular VWA domains and homologues in prokaryotes have recently been identified. The proposed VWA domains in integrin beta subunits have recently been substantiated using sequence-based methods.
InterPro ACC:IPR002035
InterPro abstract:

The von Willebrand factor is a large multimeric glycoprotein found in blood plasma. Mutant forms are involved in the aetiology of bleeding disorders [ PUBMED:8440408 ]. In von Willebrand factor, the type A domain (vWF) is the prototype for a protein superfamily. The vWF domain is found in various plasma proteins: complement … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 189 281 VWA domains in 166 516 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VWA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VWA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Divalent cations.

Relevant references for this domain

Primary literature for the VWA domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the VWA domain.

ProteinDescriptionDisease / phenotype
VWF_HUMANOMIM:193400 : von Willebrand disease
CO6A3_HUMANOMIM:120250 : Bethlem myopathy
OMIM:158810 : no description
CO7A1_HUMANOMIM:120120 : Epidermolysis bullosa dystrophica, dominant
OMIM:131750 : Epidermolysis bullosa dystrophica, recessive
OMIM:226600 : Epidermolysis bullosa, pretibial, dominant and recessive
OMIM:131850 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VWA domain which could be assigned to a KEGG orthologous group, and not all proteins containing VWA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002035
Pfamvwa