The TOPRIM domain within your query sequence starts at position 10 and ends at position 144, and its E-value is 5.04e-24.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 20334715 ) for details.

KVLCVAEKNDAAKGIADLLSNGRMRRKEGLSKFNKIYEFDYHLYGQNVTMIMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEKYCPENFIDIKKTLERETHHCQALVIWTDCDREGENIGFEIIHVCKAVKP
TOPRIM

TOPRIM

SMART ACC:SM000493
Description:topoisomerases, DnaG-type primases, OLD family nucleases and RecR proteins
InterPro ACC:IPR006171
InterPro abstract:

The Toprim (topoisomerase-primase) domain is a structurally conserved domain of ~100 amino acids that is found in bacterial DnaG-type primases, small primase-like proteins from bacteria and archaea, type IA and type II topoisomerases, bacterial and archaeal nucleases of the OLD family and bacterial DNA repair proteins of the RecR/M family. The Toprim domain can be found alone or in combination … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 94 344 TOPRIM domains in 94 335 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TOPRIM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TOPRIM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TOPRIM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TOPRIM domain which could be assigned to a KEGG orthologous group, and not all proteins containing TOPRIM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPrimase
InterProIPR006171