The IGc1 domain within your query sequence starts at position 239 and ends at position 312, and its E-value is 4.57e-39.

KVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNH
IGc1

IGc1

Immunoglobulin C-Type
SMART ACC:SM000407
Description: -
InterPro ACC:IPR003597
InterPro abstract:

The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 24 638 IGc1 domains in 22 657 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IGc1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IGc1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IGc1 domain.

ProteinDescriptionDisease / phenotype
HFE_HUMANOMIM:235200 : Hemochromatosis ; Porphyria variegata
OMIM:176200 : no description
IGHM_HUMANOMIM:147020 : Agammaglobulinemia
OMIM:601495 : no description
IGHG2_HUMANOMIM:147110 : IgG2 deficiency, selective

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IGc1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IGc1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003597
PROSITEIG_MHC
Pfamig