The XTALbg domain within your query sequence starts at position 995 and ends at position 1078, and its E-value is 8.57e-9.

KVVIFSEPDVSEECIEVFGDIQDCSSWRLSPVIVVKVVRGCWILYEKANFEGHSLALEEGELELSSIWGTEEMLDEEAESDKPV
XTALbg

XTALbg

Beta/gamma crystallins
SMART ACC:SM000247
Description:Beta/gamma crystallins
InterPro ACC:IPR001064
InterPro abstract:

The crystallins are water-soluble structural proteins that occur in high concentration in the cytoplasm of eye lens fibre cells. Four major groups of crystallin have been distinguished on the basis of size, charge and immunological properties: alpha-, beta- and gamma-crystallins occur in all vertebrate classes (though gamma-crystallins are low or absent in avian lenses); and delta-crystallin … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 301 XTALbg domains in 7 569 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing XTALbg domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing XTALbg domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the XTALbg domain.

ProteinDescriptionDisease / phenotype
CRGD_HUMANOMIM:123690 : Cataracts, punctate, progressive juvenile-onset ; Cataract, crystalline aculeiform
OMIM:115700 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a XTALbg domain which could be assigned to a KEGG orthologous group, and not all proteins containing XTALbg domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamcrystall
PROSITECRYSTALLIN_BETAGAMMA
InterProIPR001064