The LDLa domain within your query sequence starts at position 1325 and ends at position 1362, and its E-value is 1.66e-10.

LCLIDQFRCANGQCVGKHKKCDHSVDCSDRSDELDCYP
LDLa

LDLa

Low-density lipoprotein receptor domain class A
SMART ACC:SM000192
Description:Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.
InterPro ACC:IPR002172
InterPro abstract:

This entry represents the LDLR class A (cysteine-rich) repeat, which contains 6 disulphide-bound cysteines and a highly conserved cluster of negatively charged amino acids, of which many are clustered on one face of the module [ PUBMED:7603991 ]. In LDL receptors, the class A domains form the binding site for LDL and … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 170 761 LDLa domains in 37 441 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LDLa domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LDLa domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LDLa domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LDLa domain.

ProteinDescriptionDisease / phenotype
LDLR_HUMANOMIM:143890 : Hypercholesterolemia, familial

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LDLa domain which could be assigned to a KEGG orthologous group, and not all proteins containing LDLa domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamldl_recept_a
InterProIPR002172