The KAZAL domain within your query sequence starts at position 496 and ends at position 558, and its E-value is 2.43e-1.

LCRKYHTQLRNGPLRCTRRNNPIEGLDGKMYKNACFMCWAFFQQEAKKSGAGFRPKVKREVKV
KAZAL

KAZAL

Kazal type serine protease inhibitors
SMART ACC:SM000280
Description:Kazal type serine protease inhibitors and follistatin-like domains.
InterPro ACC:IPR002350
InterPro abstract:

This entry represents the Kazal domain.

Canonical serine proteinase inhibitors are distributed in a wide range of organisms from all kingdoms of life and play crucial role in various physiological mechanisms [ PUBMED:6996568 ]. They interact from the canonical proteinase-inhibitor binding loop, where P1 residue … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 40 481 KAZAL domains in 22 157 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KAZAL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KAZAL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KAZAL domain which could be assigned to a KEGG orthologous group, and not all proteins containing KAZAL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamkazal
InterProIPR002350
PROSITEKAZAL