The ClpB_D2-small domain within your query sequence starts at position 510 and ends at position 604, and its E-value is 1.16e-29.

LDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYI
ClpB_D2-small

ClpB_D2-small

C-terminal, D2-small domain, of ClpB protein
SMART ACC:SM001086
Description:This is the C-terminal domain of ClpB protein, referred to as the D2-small domain, and is a mixed alpha-beta structure. Compared with the D1-small domain (included in AAA) it lacks the long coiled-coil insertion, and instead of helix C4 contains a beta-strand (e3) that is part of a three stranded beta-pleated sheet. In Thermophilus the whole protein forms a hexamer with the D1-small and D2-small domains located on the outside of the hexamer, with the long coiled-coil being exposed on the surface. The D2-small domain is essential for oligomerisation, forming a tight interface with the D2-large domain of a neighbouring subunit and thereby providing enough binding energy to stabilise the functional assembly (PUBMED:14567920). The domain is associated with two Clp_N at the N-terminus as well as AAA and AAA_2.
InterPro ACC:IPR019489
InterPro abstract:

Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [ PUBMED:16879409 ]. This entry represents the C-terminal domain of Clp ATPases, often referred to as the D2-small domain … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 84 103 ClpB_D2-small domains in 84 095 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ClpB_D2-small domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ClpB_D2-small domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ClpB_D2-small domain which could be assigned to a KEGG orthologous group, and not all proteins containing ClpB_D2-small domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamClpB_D2-small
InterProIPR019489