The Frataxin_Cyay domain within your query sequence starts at position 87 and ends at position 198, and its E-value is 1.61e-52.

LDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLS
Frataxin_Cyay

Frataxin_Cyay

Frataxin-like domain
SMART ACC:SM001219
Description:This family contains proteins that have a domain related to the globular C-terminus of Frataxin the protein that is mutated in Friedreich's ataxia. This domain is found in a family of bacterial proteins. The function of this domain is currently unknown. It has been suggested that this family is involved in iron transport.
InterPro ACC:IPR002908
InterPro abstract:

The eukaryotic proteins in this entry include Frataxin, the protein that is mutated in Friedreich's ataxia [ PUBMED:8931268 ], and related sequences. Friedreich's ataxia is a progressive neurodegenerative disorder caused by loss of function mutations in the gene encoding Frataxin (FRDA). Frataxin mRNA is predominantly … expand

GO process:iron-sulfur cluster assembly (GO:0016226)
GO function:ferric iron binding (GO:0008199)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 591 Frataxin_Cyay domains in 4 591 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Frataxin_Cyay domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Frataxin_Cyay domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the Frataxin_Cyay domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Frataxin_Cyay domain which could be assigned to a KEGG orthologous group, and not all proteins containing Frataxin_Cyay domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002908
PfamFrataxin_Cyay