The ACR domain within your query sequence starts at position 534 and ends at position 673, and its E-value is 2.76e-56.

LDGYYCDHEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPA
ACR

ACR

ADAM Cysteine-Rich Domain
SMART ACC:SM000608
Description: -
InterPro ACC:IPR006586
InterPro abstract:

A Disintegrin and Metalloproteinase (ADAM) is a family of proteolytic enzymes that regulate shedding of membrane-bound proteins, growth factors, cytokines, ligands and receptors [ PUBMED:30905657 ]. This group of proteins are fundamental to many control processes in development and homeostasis, and they are linked to … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 215 ACR domains in 9 163 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ACR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ACR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ACR domain which could be assigned to a KEGG orthologous group, and not all proteins containing ACR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006586