The FACT-Spt16_Nlob domain within your query sequence starts at position 5 and ends at position 168, and its E-value is 2.95e-87.

LDKDAYYRRVKRLYSNWRKGEDEYASIDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLVREKNESNKSSFDKMIDAIKESKSGKKIGVFSKDKFPGEFMKSWSDCLNKEGFDKVDISAVV
FACT-Spt16_Nlob

FACT-Spt16_Nlob

FACT complex subunit SPT16 N-terminal lobe domain
SMART ACC:SM001285
Description:The FACT or facilitator of chromatin transcription complex binds to and alters the properties of nucleosomes. This family represents the N-terminal lobe of the NTD, or N-terminal domain, and acts as a protein-protein interaction domain presumably with partners outside of the FACT complex PMID:18089575. Knockout of the whole NTD domain, 1-450 residues in UniProt:P32558 in yeast serves to tender the cells sensitive to DNA replication stress but is not lethal. The C-terminal half of NTD is structurally similar to aminopeptidases, and the most highly conserved surface residues line a cleft equivalent to the aminopeptidase substrate-binding site, family peptidase_M24, (PFAM:PF00557) PMID:18089575
InterPro ACC:IPR029148
InterPro abstract:

This entry represents the N-terminal lobe domain of Spt16. Its structure is similar to the RuvC/RNase H family. It may act as a protein-protein interaction domain presumably with partners outside of the FACT complex [ PUBMED:18089575 ]. The C-terminal lobe of NTD is structurally similar to aminopeptidases, and the most … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 566 FACT-Spt16_Nlob domains in 1 566 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FACT-Spt16_Nlob domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FACT-Spt16_Nlob domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FACT-Spt16_Nlob domain which could be assigned to a KEGG orthologous group, and not all proteins containing FACT-Spt16_Nlob domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFACT-Spt16_Nlob
InterProIPR029148