The LEM domain within your query sequence starts at position 109 and ends at position 152, and its E-value is 5.83e-21.

LDVTELSNEELLDQLVRYGVNPGPIVGTTRKLYEKKLLKLREQG
LEM

LEM

in nuclear membrane-associated proteins
SMART ACC:SM000540
Description:LEM, domain in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin.
InterPro ACC:IPR003887
InterPro abstract:

The LEM (LAP2, emerin, MAN1) domain is a globular module of approximately 40 amino acids, which is mostly found in the nucleoplasmic portions of metazoan inner nuclear membrane proteins. The LEM domain has been shown to mediate binding to BAF (barrier-to-autointegration factor) and BAF-DNA complexes. BAF dimers bind to double-stranded DNA non-specifically and thereby bridge DNA molecules to form … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 325 LEM domains in 1 275 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LEM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LEM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LEM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LEM domain which could be assigned to a KEGG orthologous group, and not all proteins containing LEM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003887