The CBF domain within your query sequence starts at position 254 and ends at position 315, and its E-value is 3.92e-35.

LEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSP
CBF

CBF

CCAAT-Binding transcription Factor
SMART ACC:SM000521
Description: -
InterPro ACC:IPR001289
InterPro abstract:

Diverse DNA binding proteins are known to bind the CCAAT box, a common cis- acting element found in the promoter and enhancer regions of a large number of genes in eukaryotes. Amongst these proteins is one known as the CCAAT-binding factor (CBF) or nuclear transcription factor Y (NF-Y) [ PUBMED:1549471 ]. CBF is a heteromeric … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 697 CBF domains in 2 695 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CBF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CBF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the CBF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CBF domain which could be assigned to a KEGG orthologous group, and not all proteins containing CBF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001289
PROSITECBFB_NFYA
PfamCBFB_NFYA