The Mad3_BUB1_I domain within your query sequence starts at position 4 and ends at position 126, and its E-value is 7.41e-46.

LENVFRMFEAHMQSYTGNDPLGEWESFIKWVEENFPDNKEYLMTLLEHLMKEFLHKKNYHNDSRFINYCLKFAEYNSDRHQFFEFLYNQGIGTKSSYIYMSWAGHLEAQGELQHASAIFQTGI
Mad3_BUB1_I

Mad3_BUB1_I

Mad3/BUB1 hoMad3/BUB1 homology region 1
SMART ACC:SM000777
Description:Proteins containing this domain are checkpoint proteins involved in cell division. This region has been shown to be essential for the binding of the binding of BUB1 and MAD3 to CDC20p.
InterPro ACC:IPR013212
InterPro abstract:

Proteins containing this domain are checkpoint proteins involved in cell division. This region has been shown to be essential for the binding of Bub1 and Mad3 to Cdc20 [ PUBMED:10704439 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 311 Mad3_BUB1_I domains in 2 307 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Mad3_BUB1_I domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Mad3_BUB1_I domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Replication

Relevant references for this domain

Primary literature for the Mad3_BUB1_I domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Mad3_BUB1_I domain which could be assigned to a KEGG orthologous group, and not all proteins containing Mad3_BUB1_I domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013212
PfamMad3_BUB1_I