The TAFII55_N domain within your query sequence starts at position 12 and ends at position 178, and its E-value is 4.63e-94.

LESQFILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEAAATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVS
TAFII55_N

TAFII55_N

TAFII55 protein conserved region
SMART ACC:SM001370
Description:The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. TAFII55 binds to TAFII250 and inhibits it acetyltransferase activity. The exact role of TAFII55 is currently unknown. The conserved region is situated towards the N-terminus of the protein (PMID:11592977).
InterPro ACC:IPR006751
InterPro abstract:

The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. TAFII55 binds to TAFII250 and inhibits its acetyltransferase activity. The exact role of TAFII55 is currently unknown. The conserved region is situated towards the N-terminal … expand

GO process:transcription initiation at RNA polymerase II promoter (GO:0006367)
GO component:transcription factor TFIID complex (GO:0005669)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 896 TAFII55_N domains in 1 894 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TAFII55_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TAFII55_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TAFII55_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing TAFII55_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTAFII55_N
InterProIPR006751