The RPOL9 domain within your query sequence starts at position 3 and ends at position 53, and its E-value is 8.44e-19.

LFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVL
RPOL9

RPOL9

RNA polymerase subunit 9
SMART ACC:SM000661
Description: -
InterPro ACC:IPR001529
InterPro abstract:

This entry represents a zinc ribbon domain found at the terminal of DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerase III subunit RPC10, archaeal Transcription factor S and similar sequences.

RPB9 is the core component of RNA polymerase II, the central component of the basal RNA polymerase II transcription machinery. POLR2I/RPB9 is part of the upper jaw surrounding … expand

GO process:DNA-templated transcription (GO:0006351)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 369 RPOL9 domains in 1 364 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RPOL9 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RPOL9 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the RPOL9 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RPOL9 domain which could be assigned to a KEGG orthologous group, and not all proteins containing RPOL9 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001529
PfamRNA_POL_M_15KD