The WHEP-TRS domain within your query sequence starts at position 16 and ends at position 72, and its E-value is 3.01e-23.

LFNSIATQGELVRSLKAGNAPKDEIDSAVKMLLSLKMSYKAAMGEEYKAGCPPGNPT
WHEP-TRS

WHEP-TRS

SMART ACC:SM000991
Description:A conserved domain of 46 amino acids, called WHEP-TRS has been shown (PUBMED:1756734) to exist in a number of higher eukaryote aminoacyl-transfer RNA synthetases. This domain is present one to six times in the several enzymes. There are three copies in mammalian multifunctional aminoacyl-tRNA synthetase in a region that separates the N-terminal glutamyl-tRNA synthetase domain from the C-terminal prolyl-tRNA synthetase domain, and six copies in the intercatalytic region of the Drosophila enzyme. The domain is found at the N-terminal extremity of the mammalian tryptophanyl- tRNA synthetase and histidyl-tRNA synthetase, and the mammalian, insect, nematode and plant glycyl- tRNA synthetases (PUBMED:8463296). This domain could contain a central alpha-helical region and may play a role in the association of tRNA-synthetases into multienzyme complexes.
InterPro ACC:IPR000738
InterPro abstract:

A conserved domain of 46 amino acids, called WHEP-TRS has been shown [ PUBMED:1756734 ] to exist in a number of higher eukaryote aminoacyl-transfer RNA synthetases. This domain is present one to six times in the several enzymes. There are three copies in mammalian multifunctional aminoacyl-tRNA synthetase in a region … expand

GO process:tRNA aminoacylation for protein translation (GO:0006418)
GO function:ATP binding (GO:0005524), aminoacyl-tRNA ligase activity (GO:0004812)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 225 WHEP-TRS domains in 3 507 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WHEP-TRS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WHEP-TRS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WHEP-TRS domain which could be assigned to a KEGG orthologous group, and not all proteins containing WHEP-TRS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPF00458
InterProIPR000738