The CAP_GLY domain within your query sequence starts at position 222 and ends at position 287, and its E-value is 1.15e-33.

LGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVI
CAP_GLY

CAP_GLY

SMART ACC:SM001052
Description:Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein Q20728 CAP-Gly domain was recently solved (PUBMED:12221106). The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove (PUBMED:12221106).
InterPro ACC:IPR000938
InterPro abstract:

Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved glycine-rich domain, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of the Caenorhabditis elegans F53F4.3 protein CAP-Gly domain has been solved. The domain … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 076 CAP_GLY domains in 12 534 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CAP_GLY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CAP_GLY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the CAP_GLY domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CAP_GLY domain which could be assigned to a KEGG orthologous group, and not all proteins containing CAP_GLY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000938
PfamCAP_GLY