The Tet_JBP domain within your query sequence starts at position 1 and ends at position 352, and its E-value is 1.49e-83.

LGNEEGRPFSGVTCCMDFCAHSHKDIHNMHNGSTVVCTLIRADGRDTNCPEDEQLHVLPLYRLADTDEFGSVEGMKAKIKSGAIQVNGPTRKRRLRFTEPVPRCGKRAKMKQNHNKSGTAGLRRKRISASPKGAPGSHNTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSGAHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPLLSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLDEFWSDSEEIYADPSFGGVAIAPIHGSVLIECARKELHATTSLRSPKRGVPFRVSLVFYQHK
Tet_JBP

Tet_JBP

Oxygenase domain of the 2OGFeDO superfamily
SMART ACC:SM001333
Description:A double-stranded beta helix (DSBH) fold domain of the 2-oxoglutarate (2OG)-Fe(II)-dependent dioxygenase (2OGFeDO) superfamily found in various eukaryotes, bacteria and bacteriophages (PMID:19411852). Members of this family catalyze nucleic acid modifications, such as thymidine hydroxylation during base J synthesis in kinetoplastids (PMID:20215442) and the conversion of 5 methyl-cytosine (5-mC) to 5-hydroxymethyl-cytosine (hmC) (PMID:19372391) or further oxidation to 5-formylcytosine (5fC) and 5-carboxylcytosine (5caC) (PMID:21817016). Metazoan TET proteins contain a cysteine-rich region inserted into the core of the DSBH fold. Vertebrate TET proteins are oncogenes that are mutated in various myeloid cancers (PMID:21057493). Fungal and algal versions of this family are linked to a predicted transposase and show lineage-specific expansions (PMID:19411852).
InterPro ACC:IPR046942
InterPro abstract:

The pattern of DNA methylation at cytosine bases in the genome is tightly linked to gene expression [ PUBMED:27036965 ]. TET proteins, including TET1/2/3, convert 5-methylcytosine to 5-hydroxymethylcytosine. They can also convert 5-methylcytosine to 5-formylcytosine and 5-carboxylcytosine [ PUBMED:21778364 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 357 Tet_JBP domains in 1 357 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Tet_JBP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Tet_JBP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the Tet_JBP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Tet_JBP domain which could be assigned to a KEGG orthologous group, and not all proteins containing Tet_JBP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTet_JBP
InterProIPR046942