The RFX5_DNA_bdg domain within your query sequence starts at position 438 and ends at position 656, and its E-value is 4.29e-130.

LGPGRVPPRAPILPRGAENREVGISSDPRPHDKGIKRTAEVPLSEASGQDPPVKEMKHETQDTTVSEAKRKRGRPRKKPGGSGERNATPEKSAAIVNSPRSPRLLWETWGSKRENNFIGRPEGPGPGGEAERETVLVQGQQDGAVSKGERSLSSQEAKEAEDKIPPVTSKVSVIKGRIQKEALQLVKGEADAATQGNKGLKGRVLQSSLTPEHKDPKAT
RFX5_DNA_bdg

RFX5_DNA_bdg

RFX5 DNA-binding domain
SMART ACC:SM001306
Description:RFX5 and RFXAP reveals molecular details associated with MHCII gene expression.
InterPro ACC:IPR029298
InterPro abstract:

Transcription of all the members of MHCII family of genes is controlled by a set of conserved transcription factors and promoter elements. One of these class II transactivators is the DNA-binding RFX complex, which consists of subunits RFX5 and its accessory proteins RFXAP and RFXANK [ PUBMED:10779326 ].

This … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 128 RFX5_DNA_bdg domains in 128 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RFX5_DNA_bdg domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RFX5_DNA_bdg domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RFX5_DNA_bdg domain which could be assigned to a KEGG orthologous group, and not all proteins containing RFX5_DNA_bdg domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

InterProIPR029298
PfamRFX5_DNA_bdg